UBE2U polyclonal antibody (A01)
  • UBE2U polyclonal antibody (A01)

UBE2U polyclonal antibody (A01)

Ref: AB-H00148581-A01
UBE2U polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UBE2U.
Información adicional
Size 50 uL
Gene Name UBE2U
Gene Alias MGC35130|RP4-636O23.1
Gene Description ubiquitin-conjugating enzyme E2U (putative)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LHRDFCDLKENNYKGITAKPVSEDMMEWEVEIEGLQNSVWQGLVFQLTIHFTSEYNYAPPVVKFITIPFHPNVDPHTGQPCIDFLDNPEKWNTN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE2U (NP_689702.1, 9 a.a. ~ 102 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 148581

Enviar uma mensagem


UBE2U polyclonal antibody (A01)

UBE2U polyclonal antibody (A01)