ZNF524 MaxPab mouse polyclonal antibody (B01P)
  • ZNF524 MaxPab mouse polyclonal antibody (B01P)

ZNF524 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00147807-B01P
ZNF524 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF524 protein.
Información adicional
Size 50 ug
Gene Name ZNF524
Gene Alias MGC23143
Gene Description zinc finger protein 524
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDTPSPDPLPSPLPGEEEKPLALSPPVPRGRRGRRPGGATSSNRTLKASLHRKRGRPPKSGQEPPLVQVQGVTAPVGSSGGSDLLLIDDQGVPYTVSEGSAAGPEGSGPRKAPHFCPVCLRAFPYLSDLERHSISHSELKPHQCKVCGKTFKRSSHLRRHCNIHAGLRPFRCPLCTRRFREAGELAHHHRVHSGERPYQCPICRLRFTEANTLRRHAKRKHPEAMGVPLCAPDPGSEPPWDEEGIPATAGAEEEE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF524 (AAH67748, 1 a.a. ~ 264 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 147807

Enviar uma mensagem


ZNF524 MaxPab mouse polyclonal antibody (B01P)

ZNF524 MaxPab mouse polyclonal antibody (B01P)