APCDD1 purified MaxPab mouse polyclonal antibody (B01P)
  • APCDD1 purified MaxPab mouse polyclonal antibody (B01P)

APCDD1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00147495-B01P
APCDD1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human APCDD1 protein.
Información adicional
Size 50 ug
Gene Name APCDD1
Gene Alias B7323|DRAPC1|FP7019
Gene Description adenomatosis polyposis coli down-regulated 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSWPRRLLLRYLFPALLLHGLGEGSALLHPDSRSHPRSLEKSAWRAFKESQCHHMLKHLHNGARITVQMPPTIEGHWVSTGCEVRSGPEFITRSYRFYHNNTFKAYQFYYGSNRCTNPTYTLIIRGKIRLRQASWIIRGGTEADYQLHNVQVICHTEAVAEKLGQQVNRTCPGFLADGGPWVQDVAYDLWREENGCECTKAVNFAMHELQLIRVEKQYLHHNLDHLVEELFLGDIHTDATQRMFYRPSSYQPPLQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen APCDD1 (NP_694545.1, 1 a.a. ~ 514 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 147495

Enviar uma mensagem


APCDD1 purified MaxPab mouse polyclonal antibody (B01P)

APCDD1 purified MaxPab mouse polyclonal antibody (B01P)