TOM1L2 purified MaxPab mouse polyclonal antibody (B01P)
  • TOM1L2 purified MaxPab mouse polyclonal antibody (B01P)

TOM1L2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00146691-B01P
TOM1L2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TOM1L2 protein.
Información adicional
Size 50 ug
Gene Name TOM1L2
Gene Alias FLJ32746
Gene Description target of myb1-like 2 (chicken)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MEFLLGNPFSTPVGQCLEKATDGSLQSEDWTLNMEICDIINETEEGPKDAIRALKKRLNGNRNYREVMLALTAWADAFRSSPDLTGVVHIYEELKRKGVEFPMADLDALSPIHTPQRSVPEVDPAATMPRSQSQQRTSAGSYSSPPPAPYSAPQAPALSVTGPITANSEQIARLRSELDVVRGNTKVMSEMLTEMVPGQEDSSDLELLQELNRTCRAMQQRIVELISRVSNEEVTEELLHVNDDLNNVFLRYERF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TOM1L2 (NP_001028723.1, 1 a.a. ~ 457 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 146691

Enviar uma mensagem


TOM1L2 purified MaxPab mouse polyclonal antibody (B01P)

TOM1L2 purified MaxPab mouse polyclonal antibody (B01P)