ZNF688 MaxPab mouse polyclonal antibody (B01P)
  • ZNF688 MaxPab mouse polyclonal antibody (B01P)

ZNF688 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00146542-B01P
ZNF688 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF688 protein.
Información adicional
Size 50 ug
Gene Name ZNF688
Gene Alias -
Gene Description zinc finger protein 688
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAPPPAPLLAPRPGETRPGCRKPGTVSFADVAVYFSPEEWGCLRPAQRALYRDVMQETYGHLGALGFPGPKPALISWMEQESEAWSPAAQDPEKGERLGGARRGDVPNRKEEEPEEVPRAKGPRKAPVKESPEVLVERNPDPAISVAPARAQPPKNAAWDPTTGAQPPAPIPSMDAQAGQRRHVCTDCGRRFTYPSLLVSHRRMHSGERPFPCPECGMRFKRKFAVEAHQWIHRSCSGGRRGRRPGIRAVPRAPV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF688 (NP_660314, 1 a.a. ~ 276 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 146542

Enviar uma mensagem


ZNF688 MaxPab mouse polyclonal antibody (B01P)

ZNF688 MaxPab mouse polyclonal antibody (B01P)