TTC7B purified MaxPab mouse polyclonal antibody (B01P)
  • TTC7B purified MaxPab mouse polyclonal antibody (B01P)

TTC7B purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00145567-B01P
TTC7B purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TTC7B protein.
Información adicional
Size 50 ug
Gene Name TTC7B
Gene Alias TTC7L1|c14_5685
Gene Description tetratricopeptide repeat domain 7B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MATKKAGSRLETEIERCRSECQWERIPELVKQLSAKLIANDDMAELLLGESKLEQYLKEHPLRQGASPRGPKPQLTEVRKHLTAALDRGNLKSEFLQESNLIMAKLNYVEGDYKEALNIYARVGLDDLPLTAVPPYRLRVIAEAYATKGLCLEKLPISSSTSNLHVDREQDVITCYEKAGDIALLYLQEIERVILSNIQNRSPKPGPAPHDQELGFFLETGLQRAHVLYFKNGNLTRGVGRFRELLRAVETRTTQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TTC7B (NP_001010854.1, 1 a.a. ~ 843 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 145567

Enviar uma mensagem


TTC7B purified MaxPab mouse polyclonal antibody (B01P)

TTC7B purified MaxPab mouse polyclonal antibody (B01P)