C10orf46 polyclonal antibody (A01)
  • C10orf46 polyclonal antibody (A01)

C10orf46 polyclonal antibody (A01)

Ref: AB-H00143384-A01
C10orf46 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant C10orf46.
Información adicional
Size 50 uL
Gene Name C10orf46
Gene Alias FLJ40409|MGC33215
Gene Description chromosome 10 open reading frame 46
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq STININTSTSKFLMNVITIEDYKSTYWPKLDGAIDQLLTQSPGDYIPISYEQIYSCVYKCVCQQHSEQMYSDLIKKITNHLERVSKELQASPPDLYIERF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C10orf46 (NP_722517, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 143384

Enviar uma mensagem


C10orf46 polyclonal antibody (A01)

C10orf46 polyclonal antibody (A01)