C20orf79 MaxPab mouse polyclonal antibody (B01P)
  • C20orf79 MaxPab mouse polyclonal antibody (B01P)

C20orf79 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00140856-B01P
C20orf79 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C20orf79 protein.
Información adicional
Size 50 ug
Gene Name C20orf79
Gene Alias HSD22|MGC138229|dJ1068E13.2
Gene Description chromosome 20 open reading frame 79
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MWKRSDHQPKIKAEDGPLVGQFEVLGSVPEPAMPHPLELSEFESFPVFQDIRLHIREVGAQLVKKVNAVFQLDITKNGKTILRWTIDLKNGSGDMYPGPARLPADTVFTIPESVFMELVLGKMNPQKAFLAGKFKVSGKVLLSWKLERVFKDWAKF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C20orf79 (NP_848578.1, 1 a.a. ~ 156 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 140856

Enviar uma mensagem


C20orf79 MaxPab mouse polyclonal antibody (B01P)

C20orf79 MaxPab mouse polyclonal antibody (B01P)