ASB6 purified MaxPab mouse polyclonal antibody (B01P)
  • ASB6 purified MaxPab mouse polyclonal antibody (B01P)

ASB6 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00140459-B01P
ASB6 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ASB6 protein.
Información adicional
Size 50 ug
Gene Name ASB6
Gene Alias FLJ20548|MGC1024
Gene Description ankyrin repeat and SOCS box-containing 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPFLHGFRRIIFEYQPLVDAIPGSLGIQDPERQESLDRPSYVASEESRILVLTELLERKAHSPFYQEGVSNALLKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLVHHGADVNRRDREKLLCSMLWPAATGCRSTILRTFVSYWKEGQTSRPPPKMGTQCSPASSSCLVRPWEGTKRRPR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ASB6 (AAH01719, 1 a.a. ~ 197 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 140459

Enviar uma mensagem


ASB6 purified MaxPab mouse polyclonal antibody (B01P)

ASB6 purified MaxPab mouse polyclonal antibody (B01P)