UPRT purified MaxPab mouse polyclonal antibody (B01P)
  • UPRT purified MaxPab mouse polyclonal antibody (B01P)

UPRT purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00139596-B01P
UPRT purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human UPRT protein.
Información adicional
Size 50 ug
Gene Name UPRT
Gene Alias DKFZp781E1243|FUR1|MGC23937|UPP
Gene Description uracil phosphoribosyltransferase (FUR1) homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MATELQCPDSMPCHNQQVNSASTPSPEQLRPGDLILDHAGGNRASRAKVILLTGYAHSSLPAELDSGACGGSSLNSEGNSGSGDSSSYDAPAGNSFLEDCELSRQIGAQLKLLPMNDQIRELQTIIRDKTASRGDFMFSADRLIRLVVEEGLNQLPYKECMVTTPTGYKYEGVKFEKGNCGVSIMRSGEAMEQGLRDCCRSIRIGKILIQSDEETQRAKVYYAKFPPDIYRRKVLLMYPILSTGNTVIEAVKVLI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UPRT (NP_659489.1, 1 a.a. ~ 309 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 139596

Enviar uma mensagem


UPRT purified MaxPab mouse polyclonal antibody (B01P)

UPRT purified MaxPab mouse polyclonal antibody (B01P)