PTPDC1 purified MaxPab mouse polyclonal antibody (B01P)
  • PTPDC1 purified MaxPab mouse polyclonal antibody (B01P)

PTPDC1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00138639-B01P
PTPDC1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PTPDC1 protein.
Información adicional
Size 50 ug
Gene Name PTPDC1
Gene Alias FLJ42922|PTP9Q22
Gene Description protein tyrosine phosphatase domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAGVLPQNEQPYSTLVNNSECVANMKGNLERPTPKYTKVGERLRHVIPGHMACSMACGGRACKYENPARWSEQEQAIKGVYSSWVTDNILAMARPSSELLEKYHIIDQFLSHGIKTIINLQRPGEHASCGNPLEQESGFTYLPEAFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIACYLVFATRMTADQAIIFVRAKRPNSIQTRGQLLCVREFTQFLTPLRNIFSCCD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PTPDC1 (AAH67120.1, 1 a.a. ~ 754 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 138639

Enviar uma mensagem


PTPDC1 purified MaxPab mouse polyclonal antibody (B01P)

PTPDC1 purified MaxPab mouse polyclonal antibody (B01P)