BTBD14A MaxPab mouse polyclonal antibody (B01)
  • BTBD14A MaxPab mouse polyclonal antibody (B01)

BTBD14A MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00138151-B01
BTBD14A MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human BTBD14A protein.
Información adicional
Size 50 uL
Gene Name NACC2
Gene Alias BEND9|BTBD14|BTBD14A|MGC23427
Gene Description NACC family member 2, BEN and BTB (POZ) domain containing
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSQMLHIEIPNFGNTVLGCLNEQRLLGLYCDVSIVVKGQAFKAHRAVLAASSLYFRDLFSGNSKSAFELPGSVPPACFQQILSFCYTGRLTMTASEQLVVMYTAGFLQIQHIVERGTDLMFKVSSPHCDSQTAVIEDAGSEPQSPCNQLQPAAAAAAPYVVSPSVPIPLLTRVKHEAMELPPAGPGLAPKRPLETGPRDGVAVAAGAAVAAGTAPLKLPRVSYYGVPSLATLIPGIQQMPYPQGERTSPGASSLP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BTBD14A (NP_653254, 1 a.a. ~ 587 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 138151

Enviar uma mensagem


BTBD14A MaxPab mouse polyclonal antibody (B01)

BTBD14A MaxPab mouse polyclonal antibody (B01)