TRIM40 purified MaxPab mouse polyclonal antibody (B01P)
  • TRIM40 purified MaxPab mouse polyclonal antibody (B01P)

TRIM40 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00135644-B01P
TRIM40 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TRIM40 protein.
Información adicional
Size 50 ug
Gene Name TRIM40
Gene Alias RNF35
Gene Description tripartite motif-containing 40
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MIPLQKDNQEEGVCPICQESLKEAVSTNCGHLFCRVCLTQHVEKASASGVFCCPLCRKPCSEEVLGTGYICPNHQKRVCRFCEESRLLLCVECLVSPEHMSHHELTIENALSHYKERLNRRSRKLRKDIAELQRLKAQQEKKLQALQFQVDHGNHRLEAGPESQHQTREQLGALPQQWLGQLEHMPAEAARILDISRAVTQLRSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIYPQLEKGVSELLLQPP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRIM40 (AAH60785.1, 1 a.a. ~ 258 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 135644

Enviar uma mensagem


TRIM40 purified MaxPab mouse polyclonal antibody (B01P)

TRIM40 purified MaxPab mouse polyclonal antibody (B01P)