UBLCP1 purified MaxPab mouse polyclonal antibody (B01P)
  • UBLCP1 purified MaxPab mouse polyclonal antibody (B01P)

UBLCP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00134510-B01P
UBLCP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human UBLCP1 protein.
Información adicional
Size 50 ug
Gene Name UBLCP1
Gene Alias CPUB1|FLJ25267|MGC10067
Gene Description ubiquitin-like domain containing CTD phosphatase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGTREESLGDVLGPPPDNDDVVNDFDIEDEVVEVENREENLLKISRRVKEYKVEILNPPREGKKLLVLDVDYTLFDHRSCAETGVELMRPYLHEFLTSAYEDYDIVIWSATNMKWIEAKMKELGVSTNANYKITFMLDSAAMITVHTPRRGLIDVKPLGVIWGKFSEFYSKKNTIMFDDIG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UBLCP1 (NP_659486, 1 a.a. ~ 318 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 134510

Enviar uma mensagem


UBLCP1 purified MaxPab mouse polyclonal antibody (B01P)

UBLCP1 purified MaxPab mouse polyclonal antibody (B01P)