WDR36 polyclonal antibody (A01)
  • WDR36 polyclonal antibody (A01)

WDR36 polyclonal antibody (A01)

Ref: AB-H00134430-A01
WDR36 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant WDR36.
Información adicional
Size 50 uL
Gene Name WDR36
Gene Alias DKFZp686I1650|GLC1G|TA-WDRP|TAWDRP|UTP21
Gene Description WD repeat domain 36
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SGIETELRSLSPDCGGSIEVMQSFLKMIGMMLDRKRDFELAQAYLALFLKLHLKMLPSEPVLLEEITNLSSQVEENWTHLQSLFNQSMCILNYLKSALL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen WDR36 (NP_644810, 853 a.a. ~ 951 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 134430

Enviar uma mensagem


WDR36 polyclonal antibody (A01)

WDR36 polyclonal antibody (A01)