TMEM42 MaxPab mouse polyclonal antibody (B01)
  • TMEM42 MaxPab mouse polyclonal antibody (B01)

TMEM42 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00131616-B01
TMEM42 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human TMEM42 protein.
Información adicional
Size 50 uL
Gene Name TMEM42
Gene Alias MGC29956
Gene Description transmembrane protein 42
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAERPGPPGGAVSATAYPDTPAEFPPHLQAGAMRRRFWGVFNCLCAGAFGALAAASAKLAFGSEVSMGLCVLGIIVMASTNSLMWTFFSRGLSFSMSSAIASVTVTFSNILSSAFLGYVLYGECQEVLWWGGVFLILCGLTLIHRKLPPTWKPLPHKQQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TMEM42 (NP_653239, 1 a.a. ~ 159 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 131616

Enviar uma mensagem


TMEM42 MaxPab mouse polyclonal antibody (B01)

TMEM42 MaxPab mouse polyclonal antibody (B01)