ZPLD1 monoclonal antibody (M01), clone 1D8
  • ZPLD1 monoclonal antibody (M01), clone 1D8

ZPLD1 monoclonal antibody (M01), clone 1D8

Ref: AB-H00131368-M01
ZPLD1 monoclonal antibody (M01), clone 1D8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ZPLD1.
Información adicional
Size 100 ug
Gene Name ZPLD1
Gene Alias -
Gene Description zona pellucida-like domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq WNVLMDYCYTTPSGNPNDDIRYDLFLSCDKDPQTTVIENGRSQRGRFSFEVFRFVKHKNQKMSTVFLHCVTKLCRADDCPFLMPICSHRERRDAGRRTTW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZPLD1 (NP_778226, 244 a.a. ~ 343 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 131368
Clone Number 1D8
Iso type IgG2a Kappa

Enviar uma mensagem


ZPLD1 monoclonal antibody (M01), clone 1D8

ZPLD1 monoclonal antibody (M01), clone 1D8