Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
AHSA2 monoclonal antibody (M03), clone 3G11
Abnova
AHSA2 monoclonal antibody (M03), clone 3G11
Ref: AB-H00130872-M03
AHSA2 monoclonal antibody (M03), clone 3G11
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a full-length recombinant AHSA2.
Información adicional
Size
100 ug
Gene Name
AHSA2
Gene Alias
DKFZp564C236|FLJ34679|FLJ41715|Hch1
Gene Description
AHA1, activator of heat shock 90kDa protein ATPase homolog 2 (yeast)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
MILPTKAMATQELTVKRKLSGNTLQVQASSPVALGVRIPTVALHMMELFDTTVEQLYSIFTVKELTNKKIIMKWRCGNWPEEHYAMVALNFVPTLGQTELQLKEFLSICKEENMKFCWQKQHFEEIKGSLQLTPLNG
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
AHSA2 (NP_689605.1, 1 a.a. ~ 137 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
130872
Clone Number
3G11
Iso type
IgG1 Kappa
Enviar uma mensagem
AHSA2 monoclonal antibody (M03), clone 3G11
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*