UBR3 purified MaxPab mouse polyclonal antibody (B01P)
  • UBR3 purified MaxPab mouse polyclonal antibody (B01P)

UBR3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00130507-B01P
UBR3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human UBR3 protein.
Información adicional
Size 50 ug
Gene Name UBR3
Gene Alias DKFZp434P117|DKFZp686N10185|FLJ37422|KIAA2024|MGC126489|ZNF650
Gene Description ubiquitin protein ligase E3 component n-recognin 3 (putative)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNKRIIEEICRKVTPPVPPKKVTAAEKKTLDKEERRQKARERQQKLLAEFASRQKSFMETAMDVDSPENDIPMEITTAEPQVSEAVYDCVICGQSGPSSEDRPTGLVVLLQASSVLGQCRDNVEPKKLPISEEEQIYPWDTCAAVHDVRLSLLQRYFKDSSCLLAVSIGWEGGVYVQTCGHTLHIDCHKSYMESLRNDQVLQGFSVDKGEFTCPLCRQFANSVLPCYPGSNVENNPWQRPSNKSIQDLIKEVEEL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UBR3 (NP_742067.2, 1 a.a. ~ 741 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 130507

Enviar uma mensagem


UBR3 purified MaxPab mouse polyclonal antibody (B01P)

UBR3 purified MaxPab mouse polyclonal antibody (B01P)