ACMSD polyclonal antibody (A01)
  • ACMSD polyclonal antibody (A01)

ACMSD polyclonal antibody (A01)

Ref: AB-H00130013-A01
ACMSD polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ACMSD.
Información adicional
Size 50 uL
Gene Name ACMSD
Gene Alias -
Gene Description aminocarboxymuconate semialdehyde decarboxylase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq SHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEEFDEETKNKLKAGNALAFLGLERKQFE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACMSD (NP_612199, 179 a.a. ~ 278 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 130013

Enviar uma mensagem


ACMSD polyclonal antibody (A01)

ACMSD polyclonal antibody (A01)