VSTM2L purified MaxPab rabbit polyclonal antibody (D01P)
  • VSTM2L purified MaxPab rabbit polyclonal antibody (D01P)

VSTM2L purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00128434-D01P
VSTM2L purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human VSTM2L protein.
Información adicional
Size 100 ug
Gene Name VSTM2L
Gene Alias C20orf102|dJ1118M15.2
Gene Description V-set and transmembrane domain containing 2 like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MGAPLAVALGALHYLALFLQLGGATRPAGHAPWDNHVSGHALFTETPHDMTARTGEDVEMACSFRGSGSPSYSLEIQWWYVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGTYECRVIDFSDGKARHHKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQEACSL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen VSTM2L (NP_542174.1, 1 a.a. ~ 204 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 128434

Enviar uma mensagem


VSTM2L purified MaxPab rabbit polyclonal antibody (D01P)

VSTM2L purified MaxPab rabbit polyclonal antibody (D01P)