C20orf102 purified MaxPab mouse polyclonal antibody (B01P)
  • C20orf102 purified MaxPab mouse polyclonal antibody (B01P)

C20orf102 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00128434-B01P
C20orf102 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C20orf102 protein.
Información adicional
Size 50 ug
Gene Name VSTM2L
Gene Alias C20orf102|dJ1118M15.2
Gene Description V-set and transmembrane domain containing 2 like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGAPLAVALGALHYLALFLQLGGATRPAGHAPWDNHVSGHALFTETPHDMTARTGEDVEMACSFRGSGSPSYSLEIQWWYVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGTYECRVIDFSDGKARHHKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQEACSL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C20orf102 (NP_542174.1, 1 a.a. ~ 204 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 128434

Enviar uma mensagem


C20orf102 purified MaxPab mouse polyclonal antibody (B01P)

C20orf102 purified MaxPab mouse polyclonal antibody (B01P)