ATP6V1G3 purified MaxPab mouse polyclonal antibody (B01P)
  • ATP6V1G3 purified MaxPab mouse polyclonal antibody (B01P)

ATP6V1G3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00127124-B01P
ATP6V1G3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ATP6V1G3 protein.
Información adicional
Size 50 ug
Gene Name ATP6V1G3
Gene Alias ATP6G3|MGC119810|MGC119813|Vma10
Gene Description ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ATP6V1G3 (NP_573569.1, 1 a.a. ~ 118 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 127124

Enviar uma mensagem


ATP6V1G3 purified MaxPab mouse polyclonal antibody (B01P)

ATP6V1G3 purified MaxPab mouse polyclonal antibody (B01P)