CYP4F22 purified MaxPab rabbit polyclonal antibody (D01P)
  • CYP4F22 purified MaxPab rabbit polyclonal antibody (D01P)

CYP4F22 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00126410-D01P
CYP4F22 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CYP4F22 protein.
Información adicional
Size 100 ug
Gene Name CYP4F22
Gene Alias FLJ39501|LI3
Gene Description cytochrome P450, family 4, subfamily F, polypeptide 22
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLPITDRLLHLLGLEKTAFRIYAVSTLLLFLLFFLFRLLLRFLRLCRSFYITCRRLRCFPQPPRRNWLLGHLGMYLPNEAGLQDEKKVLDNMHHVLLVWMGPVLPLLVLVHPDYIKPLLGASAAIAPKDDLFYGFLKPWLGDGLLLSKGDKWSRHRRLLTPAFHFDILKPYMKIFNQSADIMHAKWRHLAEGSAVSLDMFEHISLMTLDSLQKCVFSYNSNCQEKMSDYISAIIELSALSVRRQYRLHHYLDFIY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CYP4F22 (AAH69351.1, 1 a.a. ~ 531 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 126410

Enviar uma mensagem


CYP4F22 purified MaxPab rabbit polyclonal antibody (D01P)

CYP4F22 purified MaxPab rabbit polyclonal antibody (D01P)