ZNF428 monoclonal antibody (M01), clone 3H4
  • ZNF428 monoclonal antibody (M01), clone 3H4

ZNF428 monoclonal antibody (M01), clone 3H4

Ref: AB-H00126299-M01
ZNF428 monoclonal antibody (M01), clone 3H4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant ZNF428.
Información adicional
Size 100 ug
Gene Name ZNF428
Gene Alias C19orf37|MGC51082|Zfp428
Gene Description zinc finger protein 428
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MTETREPAETGGYASLEEDDEDLSPGPEHSSDSEYTLSEPDSEEEEDEEEEEEETTDDPEYDPGYKVKQRLGGGRGGPSRRAPRAAQPPAQPCQLCGRSPLGEAPPGTPPCRLCCPATAPQEAPAPEGRALGEEEEEPPRAGEGRPAGREEEEEEEEEGTYHCTECEDSFDNLGELHGHFMLHARGEV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZNF428 (NP_872304.2, 1 a.a. ~ 188 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 126299
Clone Number 3H4
Iso type IgG2a Kappa

Enviar uma mensagem


ZNF428 monoclonal antibody (M01), clone 3H4

ZNF428 monoclonal antibody (M01), clone 3H4