ZSWIM7 purified MaxPab mouse polyclonal antibody (B01P)
  • ZSWIM7 purified MaxPab mouse polyclonal antibody (B01P)

ZSWIM7 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00125150-B01P
ZSWIM7 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZSWIM7 protein.
Información adicional
Size 50 ug
Gene Name ZSWIM7
Gene Alias SWS1
Gene Description zinc finger, SWIM-type containing 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAVVLPAVVEELLSEMAAAVQESARIPDEYLLSLKFLFGSSATQALDLVDRQSITLISSPSGRRVYQVLGSSSKTYTCLASCHYCSCPAFAFSVLRKSDSILCKHLLAVYLSQVMRTCQQLSVSDKQLTDILLMEKKQEA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZSWIM7 (AAI53133.1, 1 a.a. ~ 140 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 125150

Enviar uma mensagem


ZSWIM7 purified MaxPab mouse polyclonal antibody (B01P)

ZSWIM7 purified MaxPab mouse polyclonal antibody (B01P)