C17orf49 purified MaxPab mouse polyclonal antibody (B01P)
  • C17orf49 purified MaxPab mouse polyclonal antibody (B01P)

C17orf49 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00124944-B01P
C17orf49 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C17orf49 protein.
Información adicional
Size 50 ug
Gene Name C17orf49
Gene Alias MGC49942
Gene Description chromosome 17 open reading frame 49
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTSASTKVGEIFSAAGAAFTKLGELTMQLHPVADSSPAGAKWTETEIEMLRAAVKRFGDDLNHISCVIKERTVAQIKATVKRKVYEDSGIPLPAESPKKGPKKVASGVLSPPPAAPPPSSSSVPEAGGPPIKKQKADVTLSALNDSDANSDVVDIEGLGETPPAKKLNFDQA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C17orf49 (NP_777553.1, 1 a.a. ~ 172 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 124944

Enviar uma mensagem


C17orf49 purified MaxPab mouse polyclonal antibody (B01P)

C17orf49 purified MaxPab mouse polyclonal antibody (B01P)