ZPBP2 purified MaxPab mouse polyclonal antibody (B01P)
  • ZPBP2 purified MaxPab mouse polyclonal antibody (B01P)

ZPBP2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00124626-B01P
ZPBP2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZPBP2 protein.
Información adicional
Size 50 ug
Gene Name ZPBP2
Gene Alias MGC41930|ZPBPL
Gene Description zona pellucida binding protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRTCVLLSAVLWCLTGDKIYVELHQNSPVLICMDFKLSKKEIVDPTYLWIGPNEKTLTGNNRINITETGQLMVKDFLEPLSGLYTCTLSYKTVKAETQEEKTVKKRYDFMVFAYREPDYSYQMAVRFTTRSCIGRYNDVFFRVLKKILDSLISDLSCHVIEPSYKCHSVEIPEHGLIHELFIAFQVNPFAPGWKGACNGSVDCEDTTNHNILQARDRIEDFFRSQAYIFYHNFNKTLPAMHFVDHSLQVVRLDSC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZPBP2 (ENSP00000335384, 1 a.a. ~ 315 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 124626

Enviar uma mensagem


ZPBP2 purified MaxPab mouse polyclonal antibody (B01P)

ZPBP2 purified MaxPab mouse polyclonal antibody (B01P)