TTC8 monoclonal antibody (M03), clone 7E2
  • TTC8 monoclonal antibody (M03), clone 7E2

TTC8 monoclonal antibody (M03), clone 7E2

Ref: AB-H00123016-M03
TTC8 monoclonal antibody (M03), clone 7E2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TTC8.
Información adicional
Size 100 ug
Gene Name TTC8
Gene Alias BBS8
Gene Description tetratricopeptide repeat domain 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq AHQCFRLALVNNNNHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATISDKIGDLQRSYVAAQKSEAAFPDHVDTQHLIKQLRQHFAM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TTC8 (NP_653197, 416 a.a. ~ 514 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 123016
Clone Number 7E2
Iso type IgG2a Kappa

Enviar uma mensagem


TTC8 monoclonal antibody (M03), clone 7E2

TTC8 monoclonal antibody (M03), clone 7E2