C10orf4 monoclonal antibody (M02), clone 2C4
  • C10orf4 monoclonal antibody (M02), clone 2C4

C10orf4 monoclonal antibody (M02), clone 2C4

Ref: AB-H00118924-M02
C10orf4 monoclonal antibody (M02), clone 2C4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant C10orf4.
Información adicional
Size 100 ug
Gene Name C10orf4
Gene Alias F26C11.1-like|FRA10A|FRA10AC1
Gene Description chromosome 10 open reading frame 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MHGHGGYDSDFSDDERCGESSKRKKRTVEDDLLLQKPFQKEKHGKVAHKQVAAELLDREEARNRRFHLIAMDAYQRHTKFVNDYILYYGGKKEDFKRLGE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C10orf4 (NP_660289, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 118924
Clone Number 2C4
Iso type IgG1 Kappa

Enviar uma mensagem


C10orf4 monoclonal antibody (M02), clone 2C4

C10orf4 monoclonal antibody (M02), clone 2C4