ALS2CR19 monoclonal antibody (M01), clone 8D7
  • ALS2CR19 monoclonal antibody (M01), clone 8D7

ALS2CR19 monoclonal antibody (M01), clone 8D7

Ref: AB-H00117583-M01
ALS2CR19 monoclonal antibody (M01), clone 8D7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ALS2CR19.
Información adicional
Size 100 ug
Gene Name PARD3B
Gene Alias ALS2CR19|MGC16131|PAR3B|PAR3L|PAR3LC|PAR3beta|Par3Lb
Gene Description par-3 partitioning defective 3 homolog B (C. elegans)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq SPDAFETEVAAQLAAFKPIGGEIEVTPSALKLGTPLLVRRSSDPVPGPPADTQPSASHPGGQSLKLVVPDSTQNLEDREVLNGVQTELLTSPRTKDTLSDMTRTVEISG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ALS2CR19 (NP_689739, 101 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 117583
Clone Number 8D7
Iso type IgG1 Kappa

Enviar uma mensagem


ALS2CR19 monoclonal antibody (M01), clone 8D7

ALS2CR19 monoclonal antibody (M01), clone 8D7