TWIST2 monoclonal antibody (M20A), clone 3B2 View larger

Mouse monoclonal antibody raised against a partial recombinant TWIST2.

AB-H00117581-M20A

New product

TWIST2 monoclonal antibody (M20A), clone 3B2

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 200 uL
Gene Name TWIST2
Gene Alias DERMO1|MGC117334|bHLHa39
Gene Description twist homolog 2 (Drosophila)
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq GSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHER
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TWIST2 (-, 54 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 117581
Clone Number 3B2
Iso type IgM Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant TWIST2.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant TWIST2.

Mouse monoclonal antibody raised against a partial recombinant TWIST2.