AGAP1 monoclonal antibody (M01), clone 3F2
  • AGAP1 monoclonal antibody (M01), clone 3F2

AGAP1 monoclonal antibody (M01), clone 3F2

Ref: AB-H00116987-M01
AGAP1 monoclonal antibody (M01), clone 3F2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant AGAP1.
Información adicional
Size 100 ug
Gene Name AGAP1
Gene Alias CENTG2|GGAP1|KIAA1099|MGC71657
Gene Description ArfGAP with GTPase domain, ankyrin repeat and PH domain 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LPCTELSLGQHLLRATADEDLRTAILLLAHGSRDEVNETCGEGDGRTALHLACRKGNVVLAQLLIWYGVDVTARDAHGNTALAYARQASSQECIDVLLQYGCPDERFVLM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AGAP1 (NP_055729.2, 672 a.a. ~ 781 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 116987
Clone Number 3F2
Iso type IgG2b Kappa

Enviar uma mensagem


AGAP1 monoclonal antibody (M01), clone 3F2

AGAP1 monoclonal antibody (M01), clone 3F2