ZMYND19 purified MaxPab mouse polyclonal antibody (B01P)
  • ZMYND19 purified MaxPab mouse polyclonal antibody (B01P)

ZMYND19 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00116225-B01P
ZMYND19 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZMYND19 protein.
Información adicional
Size 50 ug
Gene Name ZMYND19
Gene Alias MIZIP|RP11-48C7.4
Gene Description zinc finger, MYND-type containing 19
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYSFEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHELLWERHRGGVAPGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQFPVLNVTRYYNANGDVVEEEENSCTYYECHYPPCTVIEKQLREFNICGRCQVARYCGSQCQQKDWPAHKKHCRERKRPFQHELEPER
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZMYND19 (NP_612471, 1 a.a. ~ 227 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 116225

Enviar uma mensagem


ZMYND19 purified MaxPab mouse polyclonal antibody (B01P)

ZMYND19 purified MaxPab mouse polyclonal antibody (B01P)