ZNF526 purified MaxPab mouse polyclonal antibody (B01P)
  • ZNF526 purified MaxPab mouse polyclonal antibody (B01P)

ZNF526 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00116115-B01P
ZNF526 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF526 protein.
Información adicional
Size 50 ug
Gene Name ZNF526
Gene Alias DKFZp762O059|KIAA1951|MGC4267
Gene Description zinc finger protein 526
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAEVVAEVAEMPTQMSPGAVEMSTPMSAEMMEMSTEVTEMTPGEALASSLFFQHHQFMCSECGSLYNTLEEVLSHQEQHMLAVSEEEALTTQNVGLEPELVPGAEGPFQCGECSQLILSPGELLAHQDAHLRESANQIQYQCWDCQELFPSPELWVAHRKAQHLSATVAEPPVPPPLPPPTPLPPPSPPSEVKMEPYECPECSTLCATPEEFLEHQGTHFDSLEKEERNGLEEEEEDDEEDEEDDEEMEDEEAMA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF526 (NP_597701.1, 1 a.a. ~ 670 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 116115

Enviar uma mensagem


ZNF526 purified MaxPab mouse polyclonal antibody (B01P)

ZNF526 purified MaxPab mouse polyclonal antibody (B01P)