ARL11 purified MaxPab rabbit polyclonal antibody (D01P)
  • ARL11 purified MaxPab rabbit polyclonal antibody (D01P)

ARL11 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00115761-D01P
ARL11 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ARL11 protein.
Información adicional
Size 100 ug
Gene Name ARL11
Gene Alias ARLTS1|FLJ33930|MGC17429
Gene Description ADP-ribosylation factor-like 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MGSVNSRGHKAEAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGHVSLTLWDVGGQAPLRASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANKQEAPDALPLLKIRNRLSLERFQDHCWELRGCSALTGEGLPEALQSLWSLLKSRSCMCLQARAHGAERGDSKRS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ARL11 (NP_612459.1, 1 a.a. ~ 196 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 115761

Enviar uma mensagem


ARL11 purified MaxPab rabbit polyclonal antibody (D01P)

ARL11 purified MaxPab rabbit polyclonal antibody (D01P)