ZNF689 purified MaxPab mouse polyclonal antibody (B01P)
  • ZNF689 purified MaxPab mouse polyclonal antibody (B01P)

ZNF689 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00115509-B01P
ZNF689 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZNF689 protein.
Información adicional
Size 50 ug
Gene Name ZNF689
Gene Alias DKFZp762C173|FLJ90415|TIPUH1
Gene Description zinc finger protein 689
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAPPSAPLPAQGPGKARPSRKRGRRPRALKFVDVAVYFSPEEWGCLRPAQRALYRDVMRETYGHLGALGCAGPKPALISWLERNTDDWEPAALDPQEYPRGLTVQRKSRTRKKNGEKEVFPPKEAPRKGKRGRRPSKPRLIPRQTSGGPICPDCGCTFPDHQALESHKCAQNLKKPYPCPDCGRRFSYPSLLVSHRRAHSGECPYVCDQCGKRFSQRKNLSQHQVIHTGEKPYHCPDCGRCFRRSRSLANHRTTH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF689 (NP_612456, 1 a.a. ~ 500 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 115509

Enviar uma mensagem


ZNF689 purified MaxPab mouse polyclonal antibody (B01P)

ZNF689 purified MaxPab mouse polyclonal antibody (B01P)