UHRF2 monoclonal antibody (M01), clone 3A11
  • UHRF2 monoclonal antibody (M01), clone 3A11

UHRF2 monoclonal antibody (M01), clone 3A11

Ref: AB-H00115426-M01
UHRF2 monoclonal antibody (M01), clone 3A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant UHRF2.
Información adicional
Size 100 ug
Gene Name UHRF2
Gene Alias DKFZp434B0920|DKFZp686G0837|MGC33463|NIRF|RNF107|URF2
Gene Description ubiquitin-like with PHD and ring finger domains 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,RNAi-Ab,IF
Immunogen Prot. Seq PGTSTQIEAKPCSNSPPKVKKAPRVGPSNQPSTSARARLIDPGFGIYKVNELVDARDVGLGAWFEAHIHSVTRASDGQSRGKTPLKNGSSCKRTNGNIKH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UHRF2 (NP_690856, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 115426
Clone Number 3A11
Iso type IgG2b Kappa

Enviar uma mensagem


UHRF2 monoclonal antibody (M01), clone 3A11

UHRF2 monoclonal antibody (M01), clone 3A11