UHRF2 polyclonal antibody (A01)
  • UHRF2 polyclonal antibody (A01)

UHRF2 polyclonal antibody (A01)

Ref: AB-H00115426-A01
UHRF2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant UHRF2.
Información adicional
Size 50 uL
Gene Name UHRF2
Gene Alias DKFZp434B0920|DKFZp686G0837|MGC33463|NIRF|RNF107|URF2
Gene Description ubiquitin-like with PHD and ring finger domains 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PGTSTQIEAKPCSNSPPKVKKAPRVGPSNQPSTSARARLIDPGFGIYKVNELVDARDVGLGAWFEAHIHSVTRASDGQSRGKTPLKNGSSCKRTNGNIKH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UHRF2 (NP_690856, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 115426

Enviar uma mensagem


UHRF2 polyclonal antibody (A01)

UHRF2 polyclonal antibody (A01)