VASN monoclonal antibody (M05), clone 4G7
  • VASN monoclonal antibody (M05), clone 4G7

VASN monoclonal antibody (M05), clone 4G7

Ref: AB-H00114990-M05
VASN monoclonal antibody (M05), clone 4G7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant VASN.
Información adicional
Size 50 ug
Gene Name VASN
Gene Alias SLITL2
Gene Description vasorin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq NPFNCVCPLSWFGPWVRESHVTLASPEETRCHFPPKNAGRLLLELDYADFGC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen VASN (NP_612449, 298 a.a. ~ 349 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 114990
Clone Number 4G7
Iso type IgG2a Kappa

Enviar uma mensagem


VASN monoclonal antibody (M05), clone 4G7

VASN monoclonal antibody (M05), clone 4G7