VASN purified MaxPab rabbit polyclonal antibody (D01P)
  • VASN purified MaxPab rabbit polyclonal antibody (D01P)

VASN purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00114990-D01P
VASN purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human VASN protein.
Información adicional
Size 100 ug
Gene Name VASN
Gene Alias SLITL2
Gene Description vasorin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MCSRVPLLLPLLLLLALGPGVQGCPSGCQCSQPQTVFCTARQGTTVPRDVPPDTVGLYVFENGITMLDAGSFAGLPGLQLLDLSQNQIASLPSGVFQPLANLSNLDLTANRLHEITNETFRGLRRLERLYLGKNRIRHIQPGAFDTLDRLLELKLQDNELRALPPLRLPRLLLLDLSHNSLLALEPGILDTANVEALRLAGLGLQQLDEGLFSRLRNLHDLDVSDNQLERVPPVIRGLRGLTRLRLAGNTRIAQL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen VASN (AAH68575.1, 1 a.a. ~ 673 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 114990

Enviar uma mensagem


VASN purified MaxPab rabbit polyclonal antibody (D01P)

VASN purified MaxPab rabbit polyclonal antibody (D01P)