VASN polyclonal antibody (A01)
  • VASN polyclonal antibody (A01)

VASN polyclonal antibody (A01)

Ref: AB-H00114990-A01
VASN polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant VASN.
Información adicional
Size 50 uL
Gene Name VASN
Gene Alias SLITL2
Gene Description vasorin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NPFNCVCPLSWFGPWVRESHVTLASPEETRCHFPPKNAGRLLLELDYADFGC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen VASN (NP_612449, 298 a.a. ~ 349 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 114990

Enviar uma mensagem


VASN polyclonal antibody (A01)

VASN polyclonal antibody (A01)