C1QTNF7 purified MaxPab mouse polyclonal antibody (B01P)
  • C1QTNF7 purified MaxPab mouse polyclonal antibody (B01P)

C1QTNF7 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00114905-B01P
C1QTNF7 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C1QTNF7 protein.
Información adicional
Size 50 ug
Gene Name C1QTNF7
Gene Alias CTRP7|ZACRP7
Gene Description C1q and tumor necrosis factor related protein 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MFVLLYVTSFAICASGQPRGNQLKGENYSPRYICSIPGLPGPPGPPGANGSPGPHGRIGLPGRDGRDGRKGEKGEKGTAGLRGKTGPLGLAGEKGDQGETGKKGPIGPEGEKGEVGPIGPPGPKGDRGEQGDPGLPGVCRCGSIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGIYYFSYDITLANKHLAIGLVHNGQYRIKTFDANTGNHDVASGSTVIYLQPEDEVWLEIFFTDQN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C1QTNF7 (NP_114117.1, 1 a.a. ~ 289 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 114905

Enviar uma mensagem


C1QTNF7 purified MaxPab mouse polyclonal antibody (B01P)

C1QTNF7 purified MaxPab mouse polyclonal antibody (B01P)