C1QTNF2 monoclonal antibody (M01), clone 1D7-2C7
  • C1QTNF2 monoclonal antibody (M01), clone 1D7-2C7

C1QTNF2 monoclonal antibody (M01), clone 1D7-2C7

Ref: AB-H00114898-M01
C1QTNF2 monoclonal antibody (M01), clone 1D7-2C7

Información del producto

Mouse monoclonal antibody raised against a full length recombinant C1QTNF2.
Información adicional
Size 100 ug
Gene Name C1QTNF2
Gene Alias CTRP2|zacrp2
Gene Description C1q and tumor necrosis factor related protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq DPLLGAFARRDFRKGSPQLVCSLPGPQGPPGPPGAPGPSGMMGRMGFPGKDGQDGHDGDRGDSGEEGPPGRTGNRGKPGPKGKAGAIGRAGPRGPKGVNGTPGKHGTPGKKGPKGKKGEPGLPGPCSCGSGHTKSAFSVAVTKSYPRERLPIKFDKILMNEGGHYNASSGKFVCGVPGIYYFTYDITLANKHLAIGLVHNGQYRIRTFDANTGNHDVASGSTILALKQGDEVWLQIFYSEQNGLFYDPYWTDSLF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C1QTNF2 (AAH11699.1, 16 a.a. ~ 285 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 114898
Clone Number 1D7-2C7
Iso type IgG2a kappa

Enviar uma mensagem


C1QTNF2 monoclonal antibody (M01), clone 1D7-2C7

C1QTNF2 monoclonal antibody (M01), clone 1D7-2C7