C1QTNF1 purified MaxPab rabbit polyclonal antibody (D01P)
  • C1QTNF1 purified MaxPab rabbit polyclonal antibody (D01P)

C1QTNF1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00114897-D01P
C1QTNF1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human C1QTNF1 protein.
Información adicional
Size 100 ug
Gene Name C1QTNF1
Gene Alias CTRP1|FLJ90694|GIP|ZSIG37
Gene Description C1q and tumor necrosis factor related protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGSRGQGLLLAYCLLLAFASGLVLSRVPHVQGEQQEWEGTEELPSPPDHAERAEEQHEKYRPSQDQGLPASRCLRCCDPGTSMYPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAGARGHTGPKGQKGSMGAPGERCKSHYAAFSVGRKKPMHSNHYYQTVIFDTEFVNLYDHFNMFTGKFYCYVPGLYFFSLNVHTWNQKETYLHIMKNEEEVVILFAQVGDRSIMQSQSLMLELREQDQVWVRLYKGER
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C1QTNF1 (NP_112230.1, 1 a.a. ~ 281 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 114897

Enviar uma mensagem


C1QTNF1 purified MaxPab rabbit polyclonal antibody (D01P)

C1QTNF1 purified MaxPab rabbit polyclonal antibody (D01P)