TUBGCP5 monoclonal antibody (M01), clone 2H5
  • TUBGCP5 monoclonal antibody (M01), clone 2H5

TUBGCP5 monoclonal antibody (M01), clone 2H5

Ref: AB-H00114791-M01
TUBGCP5 monoclonal antibody (M01), clone 2H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TUBGCP5.
Información adicional
Size 100 ug
Gene Name TUBGCP5
Gene Alias GCP5|KIAA1899
Gene Description tubulin, gamma complex associated protein 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MARHGPPWSRLDAQQERDVRELVRGVAGLQDEADPNFQLALNFAWSNFRFHRFLDVNSHKIEKTIEGIYEKFVIHSDLSKAASWKRLTEEFLNAPLPSI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TUBGCP5 (NP_443135.2, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 114791
Clone Number 2H5
Iso type IgG2a Kappa

Enviar uma mensagem


TUBGCP5 monoclonal antibody (M01), clone 2H5

TUBGCP5 monoclonal antibody (M01), clone 2H5