BTBD9 polyclonal antibody (A01)
  • BTBD9 polyclonal antibody (A01)

BTBD9 polyclonal antibody (A01)

Ref: AB-H00114781-A01
BTBD9 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BTBD9.
Información adicional
Size 50 uL
Gene Name BTBD9
Gene Alias FLJ32945|KIAA1880|MGC120517|MGC120519|MGC120520|dJ322I12.1
Gene Description BTB (POZ) domain containing 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RESQPEAEIPLQDTTAEAFTMLLKYIYTGRATLTDEKEEVLLDFLSLAHKYGFPELEDSTSEYLCTILN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BTBD9 (NP_689946, 2 a.a. ~ 70 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 114781

Enviar uma mensagem


BTBD9 polyclonal antibody (A01)

BTBD9 polyclonal antibody (A01)