TOE1 monoclonal antibody (M02), clone 1C12
  • TOE1 monoclonal antibody (M02), clone 1C12

TOE1 monoclonal antibody (M02), clone 1C12

Ref: AB-H00114034-M02
TOE1 monoclonal antibody (M02), clone 1C12

Información del producto

Mouse monoclonal antibody raised against a full length recombinant TOE1.
Información adicional
Size 100 ug
Gene Name TOE1
Gene Alias FLJ13949
Gene Description target of EGR1, member 1 (nuclear)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,ELISA,IF
Immunogen Prot. Seq MAADSDDGAVSAPAASDGGVSKSTTSGEELVVQVPVVDVQSNNFKEMWPSLLLAIKTANFVAVDTELSGLGDRKSLLNQCIEERYKAVCHAARTRSILSLGLACFKRQPDKGEHSYLAQVFNLTLLCMEEYVIEPKSVQFLIQHGFNFNQQYAQGIPYHKGNDKGDESQSQSVRTLFLELIRARRPLVLHNGLIDLVFLYQNFYAHLPESLGTFTADLCEMFPAGIYDTKYAAEFHARFVASYLEYAFRKCEREN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TOE1 (AAH09364, 1 a.a. ~ 510 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 114034
Clone Number 1C12
Iso type IgG1 Kappa

Enviar uma mensagem


TOE1 monoclonal antibody (M02), clone 1C12

TOE1 monoclonal antibody (M02), clone 1C12