C12orf57 polyclonal antibody (A01)
  • C12orf57 polyclonal antibody (A01)

C12orf57 polyclonal antibody (A01)

Ref: AB-H00113246-A01
C12orf57 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant C12orf57.
Información adicional
Size 50 uL
Gene Name C12orf57
Gene Alias C10|GRCC10
Gene Description chromosome 12 open reading frame 57
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MASASTQPAALSAEQAKVVLAEVIQAFSAPENAVRMDEARDNACNDMGKMLQFVLPVATQIQQEVIKAYGFSCDGEGVLKFARLVKSYEAQDPEIASLSGKLKALFLPPMTLPPHGPAAGGSVAAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C12orf57 (AAH09925, 1 a.a. ~ 126 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 113246

Enviar uma mensagem


C12orf57 polyclonal antibody (A01)

C12orf57 polyclonal antibody (A01)