TP53RK monoclonal antibody (M05), clone 2E10
  • TP53RK monoclonal antibody (M05), clone 2E10

TP53RK monoclonal antibody (M05), clone 2E10

Ref: AB-H00112858-M05
TP53RK monoclonal antibody (M05), clone 2E10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TP53RK.
Información adicional
Size 100 ug
Gene Name TP53RK
Gene Alias BUD32|C20orf64|Nori-2|Nori-2p|PRPK|dJ101A2
Gene Description TP53 regulating kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq HDEDLIHGDLTTSNMLLKPPLEQLNIVLIDFGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TP53RK (AAH09727, 154 a.a. ~ 253 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 112858
Clone Number 2E10
Iso type IgG2b Kappa

Enviar uma mensagem


TP53RK monoclonal antibody (M05), clone 2E10

TP53RK monoclonal antibody (M05), clone 2E10